DPCstruct | MC64361
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 210 ± 35 aa |
| Standard deviation of domain lengths | 34.69 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 73.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 23.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7KL81 | 1-229 | MMVVNSFQVENILLTAARTQEATVTPHLFKLIFSFYMKRSDFESAARAQYEYAFVLRTQAEQTPDLLLRRRDALAVASTLLDLLPEE… |
| A0A821QFL3 | 40-175 | QAAAAMLLTTLAERKELDALVRCAALAGEAERAAAARAKLHDAHTHNPYYDFLYSLYLSRGHFRKAAAVMYERATRCASERGGTELR… |
| A0A7R9LNU3 | 16-247 | None |
| A0A836AJP0 | 7-202 | None |
| A0A2A2KSX6 | 988-1191 | None |
| A0A0D0VCX7 | 716-951 | None |
| A0A2G5BKT2 | 418-665 | None |
| S9WEK8 | 705-864 | None |
| I0YZK2 | 1031-1277 | None |
| E4YJR3 | 136-314 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.