DPCstruct | MC64360
Metacluster Properties and Pfam Annotations
| Number of structural domains | 66 |
|---|---|
| Mean domain length (aa) | 158 ± 29 aa |
| Standard deviation of domain lengths | 29.41 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M4C4A7 | 12-168 | VVVNVATSEPNSDDDHGRLLVRAATCTWKDKADDDLRPMIPIEGEALAAWLMGTIVLPSPPGFLACTHPRATRVAMLDYPETYLEGR… |
| A0A6A3H9P1 | 45-192 | HAAVDVGKLAVLREVALRPSPVHADAALRPRTAHETEVLLAYLNKELELPHPPMFLKATMPLLQRAMLEQFHETHVEVTLTADVAPR… |
| A0A6G0SF78 | 32-230 | None |
| A0A6G0RQ81 | 115-298 | None |
| A0A2P4YU39 | 7-172 | None |
| A0A1V9YJF6 | 112-282 | None |
| K3WX36 | 46-161 | None |
| K3WF14 | 18-204 | None |
| K3W914 | 232-409 | None |
| A0A225WXN6 | 1-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.