DPCstruct | MC64351
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 222 ± 35 aa |
| Standard deviation of domain lengths | 34.57 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 64.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.30 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 22.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07898 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A3EQU9 | 2-245 | ATIYTDCLKKESINCIKYKVFSYVDKMLADKEDFTLTDGITVVKTSNANEEGAPRSIESSDLDTLLFDRLGRFLRTYSIKVDLKGTD… |
| A0A6P7G079 | 1-169 | MDLGSGLKIKSSEPERISRHATISSLPDEHRAREDALDNLLFERFSEFMKSHTFEYKVPDDTINDLNKSVEEGRKKKGGGMKMKSMM… |
| A0A6J1NX01 | 54-221 | None |
| A0A2A3EPG1 | 115-334 | None |
| A0A232FIU0 | 17-215 | None |
| A0A1I8N357 | 3-205 | None |
| A0A182J8T2 | 7-252 | None |
| A0A2W1BTE3 | 1-223 | None |
| A0A0M4EJ37 | 9-221 | None |
| A0A1Y1LKI8 | 1-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.