DPCstruct | MC64347
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 126 ± 8 aa |
| Standard deviation of domain lengths | 7.52 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 41.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z0YX54 | 264-392 | WVHRVVASKDDLKAKGALHVVHGEDVARAVVALHRQFTPGKRWIVCDMHVYDWWDLVQDWAMQSLSAAPGAVSEAEMARQGELLAWV… |
| R4X7C8 | 124-251 | FTKALFPSKQDVAAKRSLHMVHGRDVARAILAVVSDWPGPSRWMLTDGFVYDWWSLLAGWGTESSSDKDDKDDKDDDSEGDVKGEAV… |
| A0A420XXY4 | 754-873 | None |
| A0A5N6L213 | 340-479 | None |
| A0A0F7SEX8 | 64-184 | None |
| A0A7C8ILT4 | 959-1087 | None |
| L8X6A9 | 375-487 | None |
| A0A4V5NIL1 | 157-284 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.