DPCstruct | MC64346
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 252 ± 30 aa |
| Standard deviation of domain lengths | 30.17 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 49.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0106 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S4UJG1 | 2-214 | FLMKWHVYAGLAILNPIARVQIDQFARSVTDLSVLMVSNDEEGLRKRVHAGRDHVFGPPGSPRSTTPPMFLSEEIFTSFAIGEPAAG… |
| A0A1E3QT34 | 35-277 | GVAWHNCNQYPWEATRWVGGIENAKINISLRIFSNKWHVYAGLVLTNPSAHEQLLQYATSVTSLYSLMIQGKKEELKERIFRAKERV… |
| A0A0M8N6C6 | 113-395 | None |
| A0A4V1XH54 | 55-312 | None |
| A0A5N6KQE5 | 146-420 | None |
| A0A7C8J2Y3 | 67-343 | None |
| A0A381LBF7 | 2-239 | None |
| A0A0D9PCS8 | 166-440 | None |
| A0A1B7MIU7 | 47-280 | None |
| A0A0L8VUV9 | 303-584 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.