DPCstruct | MC64344
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 329 ± 32 aa |
| Standard deviation of domain lengths | 31.97 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 69.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 25.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S4UCZ5 | 1-368 | MWTEIRQRFSSQTLAWDPSAIDTRAALGAYAMAAEFQEQLPDLPVLKDLNQMQSSHMILIPFLYRLMLKPLNDNHWSQIIGLWHKLW… |
| A0A5B0NCQ5 | 321-659 | WSHFPGNEEVRRRYPCQTLDWNPAGINPDLALIAYSMVADFRKATPTTSLGVLNGENTSHELFLPFIYKLTTKPLTNYHWKHIKSVW… |
| A0A0L0W2L5 | 1-381 | None |
| A0A180G291 | 236-504 | None |
| E3K284 | 269-619 | None |
| A0A2S4WJP7 | 151-439 | None |
| A0A5B0QYE2 | 1-306 | None |
| A0A5B0N2L8 | 60-408 | None |
| A0A5B0MS18 | 217-549 | None |
| A0A0L0UWH6 | 342-659 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.