DPCstruct | MC64342
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 199 ± 22 aa |
| Standard deviation of domain lengths | 21.80 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 66.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 31.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C3EQH4 | 15-194 | RNQIQGRKARLEAELKANKSISEGDEEWLDNAGNIVDEERVVDVLDEASDYERGLGRLSQWEKTIVQKLVQLSGAGEKSNEPSKKRK… |
| A0A2S4U9A2 | 21-227 | LDLIENSYNQMQKEMLQKKEKILDKIKKNLPRTDEEEEWLDNEGNPIDEKLFIDALLGMKDNDPIQATESHIKALHKIMKYSDNIVQ… |
| A0A2S4UFX1 | 3-220 | None |
| A0A5B0Q4I0 | 7-171 | None |
| A0A2S4VG96 | 54-282 | None |
| A0A060S787 | 17-201 | None |
| A0A5B0N446 | 54-276 | None |
| A0A0L0VAB3 | 13-187 | None |
| A0A0L0V8W8 | 62-282 | None |
| A0A0C4EUU9 | 63-252 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.