DPCstruct | MC64331
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 77 ± 6 aa |
| Standard deviation of domain lengths | 6.01 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 47.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J2N2S5 | 1-82 | AKIVVSPIGSQGFIFGRGNQQISPEVIRRVGKNNIVVLATHHKLSTIDALRVDTGDPEVDEYLRGYLRVICDYREERIVKVI |
| A0A850MV25 | 135-205 | ILGRGNLQISPQVIRQVGKENIIVIATRSKLANLPRGFLRVDTRDIDLDNVLKNLYIRVIVDYNEIRIIKI |
| A0A7J3P945 | 260-340 | None |
| A0A847BPA3 | 59-128 | None |
| A0A6F9ZWX4 | 86-155 | None |
| A0A7C3ZH78 | 1-69 | None |
| A0A7Y6CEP3 | 219-300 | None |
| A0A2E6HJD4 | 549-631 | None |
| A0A662IAQ0 | 302-369 | None |
| A0A257MR10 | 247-326 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.