DPCstruct | MC6433
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 103 ± 17 aa |
| Standard deviation of domain lengths | 17.13 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 31.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P6Q5G4 | 260-343 | WGPCQICLKADDHMSLHCPYLDYVPEGASVGPGVELVCRGCGLKDKHPGMNWSKCAILKSCFICASDHWGTDCPRAKQHKTVPY |
| A0A2P6SJ50 | 11-109 | ATVFMYVKDSKKEEIRDEEEAEDGCPICLGDHFSLECPWRDNVPPGQQVGRLYDIKCKGCGKWGLACSAEGGLAVLRRCGHCFDFGH… |
| A0A830CUQ2 | 61-222 | None |
| A0A498JYF1 | 186-282 | None |
| A0A498KG36 | 1-100 | None |
| A0A2P6PJG0 | 218-325 | None |
| A0A540KIA1 | 152-262 | None |
| A0A5N5HMD1 | 173-271 | None |
| A0A5N5IBH4 | 76-202 | None |
| A0A2G5E0Z1 | 97-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.