DPCstruct | MC64327
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 76 ± 7 aa |
| Standard deviation of domain lengths | 7.03 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 26.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D9H3C8 | 2-85 | LNVRTIAWLATVMLLLISLASWSQDGNANGNITVDDILSLKSVSNPQISPDGDWIAYTVESLDFEEDESSTQIFMVSSDVAEVV |
| A0A7Y2HDS8 | 13-77 | IVFLAFTQEKERLSLEHYGDYEWTSSPQISPDGTQILYSRTWINLKDDKRETDQWIVNADGTLNR |
| A0A7W1H6H4 | 6-82 | None |
| A0A097ATU5 | 2-79 | None |
| A0A536UNX8 | 4-72 | None |
| A0A2V8R6M6 | 5-83 | None |
| A0A651FM31 | 10-98 | None |
| A0A2V8D0S5 | 19-88 | None |
| A0A0N4ZZL8 | 123-191 | None |
| A0A235IP00 | 20-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.