DPCstruct | MC64320
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 81 ± 10 aa |
| Standard deviation of domain lengths | 10.45 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 68.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00223 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J9FTZ0 | 30-113 | IPLRTAYFLVHHIHTFTIHVTVLILLKSVLFARSSHLIQDKENIDFCFPYDGPTRGGTCQVFAWDHFFLGLFWMYNSISEEILH |
| M1WY86 | 58-144 | ALGTADFMVHHIHAFTIHVTVLILLKGLLFARSSRLIPDKSNLGFRFPCDGPGRGGTCQVSGWDHVFLGLFWMYNSLSIVIFHFSWK |
| A0A2G3B988 | 30-117 | None |
| A0A396I1Z4 | 219-304 | None |
| A0A368PEM4 | 42-122 | None |
| A0A2G2XC02 | 181-274 | None |
| A0A5D2L4K0 | 27-99 | None |
| A0A4S8I2Y4 | 870-957 | None |
| A0A5D2T0W5 | 12-88 | None |
| A0A7J9KA92 | 76-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.