DPCstruct | MC6432
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 211 ± 20 aa |
| Standard deviation of domain lengths | 20.39 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 16.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183EUY0 | 1-208 | MDKVFEGRIVPSLKGEVSALRRALTYMLNNFWDETFWLRKMNDKIILQIPTSASAALNEKLSAMDVLNLIDGKISKFASTLMQYFCQ… |
| A0A2P6SDF1 | 1-218 | MRFMDNAVRFERESNRIRVKYVLSIDGNHGIELKTVLQALDMVGILHYGLAKVADLMIKHVISPALNSGSPVSFVTEINPDSQAMTE… |
| A0A453SHW9 | 56-269 | None |
| A0A6P9AXE0 | 183-421 | None |
| A0A6A4VTB0 | 159-348 | None |
| A0A0R3T9X3 | 246-490 | None |
| A0A1X2HT26 | 183-361 | None |
| A0A433A3J9 | 260-466 | None |
| A0A433QKN2 | 14-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.