DPCstruct | MC64318
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 376 ± 73 aa |
| Standard deviation of domain lengths | 72.88 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 21.66 |
| Pfam Score | 74.81 |
| Assigned Pfam label(s) | PF16595- CL0263- PF18061- PF18541- CL0693 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7U7VT09 | 2-394 | KALETIKELKLEETSKNIQIVRLFEDQKGICPYSGLKMDLKCLDELVIDYIRPYNRSLDDSYSNKVLTFKKLNDLKQGKTPFEAFGE… |
| W4VJG2 | 2-366 | RIINAIIKKYGMPSEIVIELAREKNSDDKKKFLRDMNKRNEAINKQVRDKLESKDLNPSKGLFNKLRLWHLQDGMCMYSLKSIPIED… |
| A0A1H7I2G4 | 227-653 | None |
| A0A355TRL9 | 19-317 | None |
| A0A522UD61 | 101-650 | None |
| A0A2Z4I808 | 489-894 | None |
| A0A2K2Z283 | 1-408 | None |
| A0A389M5Z5 | 521-773 | None |
| A0A3N0I477 | 13-445 | None |
| A0A0X8KN88 | 592-1005 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.