DPCstruct | MC64312
Metacluster Properties and Pfam Annotations
| Number of structural domains | 4386 |
|---|---|
| Mean domain length (aa) | 203 ± 53 aa |
| Standard deviation of domain lengths | 52.79 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 77.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 17.66 |
| Pfam Score | 87.99 |
| Assigned Pfam label(s) | PF19788- CL0681- PF05231- PF06580- PF19191 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R6XM89 | 16-179 | STEQGERLARAAMLVDQLSTRVHAAAWNLRPADLDHLGLRASVEDLAAMLCAQLDIPCDMDLEALSCPLAPEVALTLYRVAQEALTN… |
| A0A7V9P4L7 | 1-117 | RLESVDSLGLARAAAAELEDGTVRVSGEGAPVSVEPDATRRALRQLSRAARRHGGLESVELRVRGAELELGPITRTAGVVVTGEELR… |
| A0A538PX25 | 544-758 | None |
| V4IVX4 | 118-343 | None |
| A0A538Q684 | 449-706 | None |
| A0A5J6F057 | 13-153 | None |
| A0A3M1BV61 | 2-361 | None |
| A0A1M3F9P4 | 2-97 | None |
| A0A7G6E7A4 | 176-409 | None |
| A0A4Q5L1V3 | 320-561 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.