DPCstruct | MC64309
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 106 ± 20 aa |
| Standard deviation of domain lengths | 19.76 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 76.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 18.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13146 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D1N2D0 | 12-115 | LFLAGCVHYMPAAVSSTSIGSKYETPVRTVTGTSSAYYIFGLGPTGDDSLNAAIEDAKSQAPSDSIANVFVDRKLICIPVCGFSIFT… |
| A0A7C7XXS0 | 8-108 | LGTACTHYAPMQVSTSPVGSGNEVPVKVATGESTASVLFGFVVLSGNDSLSAALQDALEGTEADTMMNVFVDRQAFCVPACWFPLYL… |
| A0A3D8J9C0 | 4-61 | None |
| A0A7Y5BKV9 | 7-137 | None |
| A0A2P2DLF1 | 2-79 | None |
| A0A2E8PUT9 | 5-112 | None |
| A0A0B4XQR5 | 53-156 | None |
| A0A2R4L4R6 | 1-114 | None |
| R6ZV82 | 8-135 | None |
| A0A806KM01 | 9-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.