DPCstruct | MC64303
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 137 ± 12 aa |
| Standard deviation of domain lengths | 12.23 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 26.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A5SYD5 | 26-142 | HNSGYKVPFVHPENIFLIDGNFSYVHIGTREGVAPMNFDSELFLSQYKALSLAILNPKISYDNFVNGETSLRDKFSQAIASCDSFEE… |
| Q7A1V2 | 86-240 | IKSFTKNEKLRYLLNIKNLEEVNRTRYTFVLAPDELFFTRDGLPIAKTRGLQNVVDPLPVSEAEFLTRYKALVICAFNEKQSFDALV… |
| A0A0A5GD23 | 78-232 | None |
| J6Y6E3 | 74-214 | None |
| R3KK15 | 1-144 | None |
| W7C4S1 | 13-165 | None |
| A0A366UDE3 | 3-126 | None |
| A0A2C1KG57 | 4-132 | None |
| A0A290PYJ4 | 1-133 | None |
| W9EDS4 | 75-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.