DPCstruct | MC6430
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 334 ± 76 aa |
| Standard deviation of domain lengths | 75.83 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 81.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 20.30 |
| Pfam Score | 88.50 |
| Assigned Pfam label(s) | PF05938- CL0231- CL0188 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C1C4W4 | 5-223 | DKLTFPRFSVVDLVNFFRQNILTAAEAKNFTKADIYPNPKLEWVQKIYMRILQQVFNLRVEHFYMVPVDLEIPYPHLVEGFAPLGYI… |
| A0A2P6SCN1 | 1-328 | MSKLVYPKLSRTEIVTILVEAQIIAISEQDLLNPNPDLIADLYTRILTTFDFLPAEDEQVDFDALALLENPDFHDKSARSIKLYNTL… |
| A0A3S3NAS9 | 1-269 | None |
| A0A6S7GFP8 | 299-690 | None |
| A0A2G2X1B1 | 1-277 | None |
| V9EF45 | 474-854 | None |
| I2H7A0 | 2-486 | None |
| A0A7J7IBM2 | 40-420 | None |
| A0A5A8D547 | 20-399 | None |
| A0A0A6YW74 | 1-285 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.