DPCstruct | MC643
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 130 ± 8 aa |
| Standard deviation of domain lengths | 8.11 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 33.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G7EKT6 | 44-169 | DLIGDLTAIRIPLPQPGDVTPEELYPDAREEAEQAREEYAFALGALCDEVQEDPLLIALGNARAAREAADREIRHLLAYGREFHGDR… |
| A0A3L8IK53 | 1-143 | MSVYEHIAAIRHPMPEPGDVPEEVFNDVCHETDHARKETAFHLEAAWDADPEANEPLMSAIGAARYRRDAAEAEIRRLVAYGREFTR… |
| A0A7H8TM25 | 48-159 | None |
| A0A367EJB1 | 1-133 | None |
| A0A852Z5Z9 | 1-135 | None |
| A0A841FQJ4 | 1-119 | None |
| A0A1X2FJN6 | 2-134 | None |
| A0A2T0SNU7 | 2-128 | None |
| A0A4V4HP84 | 1-134 | None |
| A0A4S8P2V6 | 72-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.