DPCstruct | MC64299
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 758 ± 98 aa |
| Standard deviation of domain lengths | 98.13 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 34.35 |
| Pfam Score | 71.43 |
| Assigned Pfam label(s) | PF00476- PF18136 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A2LQQ5 | 79-922 | AMVASMFGMADHQETMYKTRRAQTDGMDDSDPALSQVGPIEGNSEDQKGDGWIREWKKRVSPKGLADVHKYLYPNKKPLDKQYQNFF… |
| C4YCA9 | 1-669 | MDKDLRDTFSSTNVEDVVSDFQNLMHYCASDVEATFAVAQKLYPQFRAKTPHPVSFAALKSLGSLVLPTTKKWNNYIESAEKVYDEN… |
| A0A183SUF8 | 45-819 | None |
| A0A369RSU6 | 192-1143 | None |
| A0A6A4JS79 | 4-613 | None |
| A0A1Z5T4U4 | 2-638 | None |
| A0A1Q2YJM5 | 14-824 | None |
| A0A4Y7NN91 | 1-734 | None |
| Q9Y767 | 214-1024 | None |
| A0A4R8QLL7 | 2-741 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.