DPCstruct | MC64298
Metacluster Properties and Pfam Annotations
| Number of structural domains | 190 |
|---|---|
| Mean domain length (aa) | 200 ± 43 aa |
| Standard deviation of domain lengths | 42.65 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 81.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 28.89 |
| Pfam Score | 99.61 |
| Assigned Pfam label(s) | CL0031- CL0129 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A833S8S9 | 195-395 | FCQTGDITNSLQRLCVTESQQNDKEQNKPLWEKTDKANLWILPVIQGYVQIEKCKVEVGIDEQPHHETFNLAIISRRSRFRAGTRYK… |
| A0A0J8B817 | 10-152 | LDPYLLPVVQGSFHHFQAAIGKDIVDVTVIARRCTRRTGTRMWRRGADPDGYVANFVETEQIMQLNGYATSFVQVCGSMPFLWEQIV… |
| A0A3P7CHM1 | 108-316 | None |
| A0A1W0E2T9 | 26-187 | None |
| A0A3Q4IH95 | 59-166 | None |
| A0A482WLB5 | 1-131 | None |
| A0A4U0VYT2 | 116-333 | None |
| A0A4S4D9Y3 | 3-122 | None |
| A0A0V0QE67 | 164-438 | None |
| A0A0V0QNA8 | 44-230 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.