DPCstruct | MC64295
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 107 ± 17 aa |
| Standard deviation of domain lengths | 17.31 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 46.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05640 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9I5T9 | 39-111 | TEDSDVLNLGTGSVSWWEVNGAGCRPIYPTNLTVDDPYPFRPLRPDKVMDCVLDYKYVETFHAALQCLLAAIM |
| A0A7R8UC35 | 65-178 | YLIWNFIWIGWNVFLICFYLDVGVLDKDSDILNLGTGSVSWFEVNGYGCIPTYPTNITNEDLSRPVRPEQVDSCLIDYPIVEVIHSG… |
| T1JIC9 | 17-132 | None |
| A0A0M4EV47 | 67-178 | None |
| A0A444TR84 | 33-147 | None |
| A0A182M3H4 | 49-131 | None |
| A0A6M2DYF3 | 35-159 | None |
| A0A6G0T646 | 65-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.