DPCstruct | MC64290
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 267 ± 69 aa |
| Standard deviation of domain lengths | 69.04 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 83.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05936 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4T8SLR3 | 56-328 | IRDGQNAWRQDPSFIPPVALFGASPVLRERLVLLNRQLRSRRQRLMAMRRESNERLADFAVADVSLFWLLNALNSHASVLTEYERFP… |
| I3I5E2 | 73-400 | NTQGLARYYPTELAVRDVTQEGGEDHAIDIAKLRLRLMLDTDDLSGYVCIAFIRIAEARDDKNIILDEQFLATCLDCRASLKLTSFI… |
| A0A7C0WAD2 | 18-482 | None |
| A0A5E5QS98 | 3-210 | None |
| A0A2V0QAU1 | 34-269 | None |
| A0A3M2WBC3 | 302-548 | None |
| A3Y8M8 | 5-197 | None |
| A0A447WC42 | 702-962 | None |
| E9KSL3 | 330-591 | None |
| A0A2D5I2J9 | 87-354 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.