DPCstruct | MC6429
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 72 ± 4 aa |
| Standard deviation of domain lengths | 4.38 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 93.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 29.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0310 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A350UFJ7 | 274-347 | RWLAWLDGQDRDSLTAALQYRDLKGNLHATPLWQLLLHVVNHASHHRGQVSAMLRAMGRTPPPVDLIFYYRSLA |
| A0A228PV40 | 2-71 | TDWVDGQDAASLAETVSFEFVSGRAAQMARGAMLLHLYNHKTYHRGWVCQMLFELGVTPPETDLPVYLSR |
| A0A1F5YGS2 | 1-64 | None |
| A0A841HX42 | 8-84 | None |
| G8PZU0 | 31-109 | None |
| A0A7T9EDK4 | 26-94 | None |
| A0A2V7HNK7 | 11-85 | None |
| A0A0K2ZEX6 | 13-80 | None |
| A0A524PZM0 | 28-104 | None |
| A0A6M5YAE4 | 4-67 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.