DPCstruct | MC64289
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 346 ± 97 aa |
| Standard deviation of domain lengths | 97.26 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 83.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 21.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0010- CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4T8SLY6 | 6-357 | KIVWPIPSSRRGSEFKNQEEILSHLGGESTGLYMIGRSGMWHGGIHITEATTPWCALSGKSPLEAIDFPVPFKGEQAIRCMADGEVI… |
| A0A317Q6D5 | 2-306 | KICFPARKADGKDYSTLDEMMAQVGREPHGTWLAGTNAMWHGGIHITRESAPASVLTSENLDTAVPLSFMAGGEVVAYRLNSQYLSD… |
| A0A7T8M2F1 | 1-264 | None |
| A0A4Q8RXZ9 | 2-361 | None |
| A0A443TYL4 | 9-269 | None |
| A0A7X5AZB8 | 1-322 | None |
| A0A447QSI0 | 144-461 | None |
| A0A3M1TQM8 | 258-544 | None |
| A0A1H1LQD9 | 186-586 | None |
| A0A2N6FQ06 | 6-412 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.