DPCstruct | MC64283
Metacluster Properties and Pfam Annotations
| Number of structural domains | 78 |
|---|---|
| Mean domain length (aa) | 95 ± 17 aa |
| Standard deviation of domain lengths | 17.48 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 91.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 43.54 |
| Pfam Score | 95.45 |
| Assigned Pfam label(s) | CL0007- CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X6WSE5 | 1-66 | IAREAGSRTKIAVIAKEEGIDPIGSCVGQKGTRVQAIIDELGGEKIDIIEWNENIEKFISASLSPA |
| A0A0G0DAR1 | 157-233 | EISQDKFGNPRIIISRADPRLIKELFKREVPEISNNTVVIKKVVREPGERSKIAVTTTTGGVDPVGACVGQKGARKQ |
| A0A376FCI6 | 2-82 | None |
| A0A1V1PBG2 | 170-285 | None |
| A0A831NPM9 | 115-220 | None |
| A0A7V0U9K3 | 41-154 | None |
| A0A7X0G683 | 58-178 | None |
| A0A536S1I2 | 135-233 | None |
| A0A3M1GQ92 | 193-306 | None |
| A0A838Q7I8 | 1-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.