DPCstruct | MC64282
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 111 ± 10 aa |
| Standard deviation of domain lengths | 10.28 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 32.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H9WDV4 | 10-115 | GSADYRKTFFTAHPHLKGTVVVHHAVERQAERRYPTAGLTPEEINSLENLRGISKGDVNNRMHLSALRIAWNRFYAKNVSASKQDLL… |
| A0A068NTY0 | 604-714 | SATVGHAPSSDYATTFFNAFPHLKGKVYIHHAVERRVLNKYPNLCTPEQIHSLENLRGIPWKSNPKVHLSYIRIEWNKFYKAHPNAT… |
| A0A562C6N7 | 48-172 | None |
| A0A0C1Y418 | 152-259 | None |
| A0A857V8F3 | 105-211 | None |
| A0A1H3RNB2 | 145-245 | None |
| X6GNS4 | 27-139 | None |
| A0A839LJM9 | 274-384 | None |
| A0A7V6W6W5 | 9-112 | None |
| A0A645IN94 | 74-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.