DPCstruct | MC64276
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 165 ± 20 aa |
| Standard deviation of domain lengths | 20.26 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1W3A3 | 1-165 | DVEDAAVQADFSRRSERIMGVAEVPSNKPRIFVRLLNDSRELDLALQLRHVLKRVFPLAPVYLLLIVDMQLEKGPKRLEGVAGDGIL… |
| A0A7S0ZN13 | 264-421 | SAKVKFEFERRVDRFYGKRHNEAPSCKPRIFVRIANSSREICSTLRLHRALKCALPEAKVRLLVIIDLQRKSDLVCLQNIEDVLFCR… |
| A0A7S4PLR6 | 46-192 | None |
| A0A7S1W5Z3 | 96-232 | None |
| A0A7S4Q9Y6 | 188-342 | None |
| A0A7S4Q2Y9 | 583-750 | None |
| A0A7S4PVQ4 | 32-184 | None |
| A0A813D833 | 123-291 | None |
| A0A812LSA4 | 93-298 | None |
| A0A7S1F5S0 | 469-657 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.