DPCstruct | MC64271
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 91 ± 13 aa |
| Standard deviation of domain lengths | 12.69 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 31.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4RJE2 | 206-298 | GQPPRPRSFRVHVPEPYPGVQYRRSKNLNDRYLRYAENGSVIAGQLEDDGAWLRVSASVFVPVRVGGNEILEPVPDEEVSRQGRTQE… |
| A0A812ZVV2 | 281-351 | RKEFLVDNELLQAPTSGLSYFFSKSLDDVDAGKTAMWGQVVVGKRHGEWVKVGHCCYLPTSLNGVQVLRED |
| A0A813D9J2 | 163-244 | None |
| A0A7S2KE88 | 44-165 | None |
| A0A7S4R709 | 9-98 | None |
| A0A7S1W7R5 | 109-193 | None |
| A0A7S2CDG3 | 190-278 | None |
| A0A812R1Z8 | 149-239 | None |
| A0A1Q9DAI8 | 264-372 | None |
| A0A7S2HZJ8 | 49-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.