DPCstruct | MC6427
Metacluster Properties and Pfam Annotations
| Number of structural domains | 225 |
|---|---|
| Mean domain length (aa) | 195 ± 34 aa |
| Standard deviation of domain lengths | 33.85 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.60 |
| Pfam Score | 98.39 |
| Assigned Pfam label(s) | CL0260- CL0598- CL0037 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A256H1B0 | 2-145 | IAVEDPNYSTHSGVDFSTPGAGLTTITQSAAKRLAFEQFHPGPGKIRQTGYALGMERRLSKEQILALWLETLEMGKGPDGWIVGFHS… |
| A0A6I6DFG9 | 35-242 | WDNPEPLYLENIKIEKVGDSLVLGYTERNIKYVELHDIPQDLINAFIAIEDNRFFQHRGVDVKGVIRAIAVNIYFKELAQGGSTITQ… |
| A0A7C1RT88 | 6-135 | None |
| A0A537THJ2 | 38-262 | None |
| A0A6G8G1R7 | 81-247 | None |
| A0A1E3G1V6 | 35-255 | None |
| A0A1A9UKJ3 | 2-171 | None |
| A0A6G3V974 | 1-130 | None |
| A0A812IYI2 | 284-478 | None |
| A0A3C1KWU0 | 729-886 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.