DPCstruct | MC64268
Metacluster Properties and Pfam Annotations
| Number of structural domains | 90 |
|---|---|
| Mean domain length (aa) | 124 ± 18 aa |
| Standard deviation of domain lengths | 17.76 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.50 |
| Pfam Score | 75.73 |
| Assigned Pfam label(s) | PF04446- PF14413 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B1PRW3 | 372-486 | TLKRPPCFDGRAVLYPNDATMMDYLKWRQADCHINNLYNTAFWKLVLELGWTCAEAQARLRGSTSADKNELLFSMFNTNYNNEPQLF… |
| A0A4Q2YVE6 | 3-130 | VFDCRMIPLPSEVEVVEYFRWRAEDARRNCLNAHCYWTLRNKENSASAATEAIRYLAAAEKVDLLRREAGMEFEALPSWQRNGVGLR… |
| A0A443NEE5 | 151-286 | None |
| A0A2V1D8A1 | 146-255 | None |
| A0A834MZG3 | 146-267 | None |
| A0A1T3P8D4 | 346-462 | None |
| A0A654HHB8 | 566-667 | None |
| A0A3D3LGS6 | 130-250 | None |
| A0A5J5VRG7 | 138-258 | None |
| D5HGM8 | 1-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.