DPCstruct | MC64265
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 289 ± 38 aa |
| Standard deviation of domain lengths | 37.50 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 32.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q2Y8M8 | 2-320 | INSRLIPYISGGGDAATVAEQFIDRTKNDEALASKSFAANAMINGAFNVNSTSVDAWRAVLSSMRDAAVSGYSANGTNVRYGVGEKT… |
| A0A3D0YMY0 | 868-1177 | NRAYLPIQEDQVDNSTKASELYSDEVQPADSWKTIASRLEVQGMFNVNSTSVKAWRALLGHARNHKIPYTKTDGSVAISDKTNYATS… |
| A0A7X1AWM7 | 995-1272 | None |
| A0A0R2XL89 | 1-278 | None |
| A0A2G4F7S4 | 708-1056 | None |
| A0A4Q2Y055 | 262-534 | None |
| A0A6N2CTZ0 | 434-728 | None |
| A0A2E3A4K6 | 72-408 | None |
| A0A2E3N9V4 | 52-362 | None |
| A0A7Y1UIU7 | 692-950 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.