DPCstruct | MC64260
Metacluster Properties and Pfam Annotations
| Number of structural domains | 133 |
|---|---|
| Mean domain length (aa) | 91 ± 16 aa |
| Standard deviation of domain lengths | 16.16 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 93.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 31.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0061 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A447JR16 | 20-116 | AITDKTRAIVPVHYAGVACEMDVIMALADKYNLFVVEDAAQGVMSTYKGRALGTIGHIGCFSFHETKNYTAGGEGGATLINDRTLIE… |
| A0A3D2S0T7 | 12-92 | REKSLHIQKQSLPVHMQGVPGRIDQIVDVANRHNLQIFEDCCQCIGGRYRGCFVGTIGNAGAWSLNFFKIISTGEGGLIFT |
| A0A1D8U0H8 | 145-228 | None |
| A0A496STR0 | 32-113 | None |
| A0A482ZWR0 | 253-347 | None |
| A0A1V5YQ75 | 52-131 | None |
| A0A1Q9BX87 | 543-627 | None |
| A0A7M7G002 | 121-211 | None |
| A0A1B0ZJC0 | 2-65 | None |
| A0A1V1PG52 | 1-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.