DPCstruct | MC6426
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 59 ± 6 aa |
| Standard deviation of domain lengths | 6.13 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 57.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00269 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A645ICS7 | 2-58 | AIVPEAKNGLDTLKYEVASSLGVNLKQGYNGDLTAKQNGSVGGEMVKRLIAQAQSGL |
| A0A6I6DCP8 | 7-64 | QILVPQAKAAMDQFKYEAAQEVGVNLKQGYNGDLTSRQAGSIGGQMVKKMVYAYQQNQ |
| A0A7C6V240 | 1-69 | None |
| R5GJL5 | 1-53 | None |
| A0A173WME8 | 3-61 | None |
| A0A7X9BP93 | 5-63 | None |
| A0A1K1LK64 | 5-59 | None |
| A0A4S2AHX7 | 5-67 | None |
| R6FV41 | 2-60 | None |
| A0A847NE75 | 3-65 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.