DPCstruct | MC64255
Metacluster Properties and Pfam Annotations
| Number of structural domains | 493 |
|---|---|
| Mean domain length (aa) | 118 ± 19 aa |
| Standard deviation of domain lengths | 19.17 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 16.40 |
| Pfam Score | 96.64 |
| Assigned Pfam label(s) | CL0023- PF08797- CL0479 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G9ETB7 | 350-450 | IIENVSVPQEKLPVVGIKIAERQSFVNQLVIDEEVYLERDYKNNFDDNAIRVINKSGKMLGYISAEWTDIYAVKIDLGMIFKCTVLN… |
| A0A136P2W3 | 13-127 | RLAKQQSTGVDTYDVHVVGVTFEGRQQVVRSIQANDRLLLRRDPANRYDRNAIRVETLNGVQVGFLAKDLAAQLASRFDQLGAPVNA… |
| A0A810LVT7 | 17-141 | None |
| G8S5A2 | 29-151 | None |
| A0A4R3YV25 | 120-229 | None |
| A0A4P8PNW9 | 19-156 | None |
| A0A1Q7WI15 | 2-87 | None |
| A0A416P7T5 | 60-184 | None |
| A0A1S2HW71 | 108-224 | None |
| A0A2W5B5X2 | 1-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.