DPCstruct | MC64252
Metacluster Properties and Pfam Annotations
| Number of structural domains | 984 |
|---|---|
| Mean domain length (aa) | 157 ± 32 aa |
| Standard deviation of domain lengths | 31.82 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 85.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 25.29 |
| Pfam Score | 99.14 |
| Assigned Pfam label(s) | CL0475- PF10585- CL0063- CL0046- PF02271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A521K971 | 6-154 | NTNQGAIVIEFFGDDAPNTVENFKKLAESGYYNGTKFHRVIPGFMVQGGDPFTKDDSLSGKWGTGGPGYTFEDEIHANNKNDIGTIS… |
| A0A419G6M9 | 5-119 | PELMPVTAGNFEKLVQSNFYDGLVFHRVEDWVIQGGDPKGNGTGGPGWTIPLETSPKLKNVRGAVAMARSKNPDSAGSQFYILKKDA… |
| A0A7S2UKX2 | 80-281 | None |
| A0A654HG56 | 712-835 | None |
| A0A7S4E4Q0 | 204-365 | None |
| A0A7S3ZWC5 | 17-196 | None |
| A0A6P5GAU1 | 85-209 | None |
| A0A5N4A7L9 | 127-285 | None |
| A0A522XAJ4 | 4-194 | None |
| A0A7C1KWU9 | 2-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.