DPCstruct | MC6424
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 205 ± 26 aa |
| Standard deviation of domain lengths | 25.90 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 17.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S7TLV4 | 184-396 | YKRINKEDFIFSKSDWYTSSKNIIEVYKDQNIDHYLINNFDQNADFYIKLDNRSYLNLKEESIVFGPIIIPFKYRFGHTKNGVDISA… |
| W8F1N2 | 19-223 | TIAPDSFTTNNVNGQKITTSDSKAISKADIQESVDESYYYTLNYDPATGLDRYFLISADQLAASAAVLAARFTPTAGAVVMPFKFRP… |
| A0A4R1IEF9 | 14-239 | None |
| A0A136MXA5 | 2-165 | None |
| A0A3N4MA42 | 62-284 | None |
| A0A4Q3MPW7 | 1-209 | None |
| A0A2T7BJ43 | 144-348 | None |
| A0A7C6Q4Y3 | 1-135 | None |
| A0A4V5PXH9 | 75-289 | None |
| L8JX82 | 14-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.