DPCstruct | MC64237
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 132 ± 12 aa |
| Standard deviation of domain lengths | 11.62 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 47.66 |
| Pfam Score | 86.62 |
| Assigned Pfam label(s) | PF03460- CL0667 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A011PGL3 | 1-148 | MPAFASGSCRRRSAAYTLAASNRKPACACTDHLHQEVRDAIRVQHFLGIDGVMPFLEWKTDDGCDKCRPVLNYCLLSTWSGEARDDP… |
| A0A810ZDL3 | 35-161 | EVKKDICEHFPWSRQELYSLIRMGNIKSFEELLAKQGRGNGCEICKPLVGSMLASCWNDYLLTPALLPLQDTNDRYFANIQKDGTYS… |
| A0A6I1ISC8 | 41-162 | None |
| A0A0B8PBW1 | 59-173 | None |
| A0A376FBY7 | 1-156 | None |
| A0A1W9F6L3 | 57-193 | None |
| A0A377DLR7 | 284-428 | None |
| W4Q9Z6 | 472-604 | None |
| D2A9G4 | 379-500 | None |
| A0A485CLV1 | 8-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.