DPCstruct | MC64234
Metacluster Properties and Pfam Annotations
| Number of structural domains | 174 |
|---|---|
| Mean domain length (aa) | 149 ± 21 aa |
| Standard deviation of domain lengths | 20.71 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 18.80 |
| Pfam Score | 96.49 |
| Assigned Pfam label(s) | CL0110- PF04138- CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1BDW0 | 329-471 | VPVPGGVPAERGWLARVSLFGVVSVATTALDFALFNVLVSGGSTGPVLANVVSYSAGVLASYTLNKRYTFAGGGRDRVSQELGMFLL… |
| A0A4V1U4J6 | 10-129 | IPTGLRFCISGSLATAAHYLVMAGAIGLGWSSGAATALGAAIGALLNYVLQYSFTFRATGGHGHASPRYLLSVLLSWLLNLVFFLVL… |
| A0A7J3G340 | 1-119 | None |
| A0A1G3XQP6 | 120-270 | None |
| A0A2E0BEL2 | 16-132 | None |
| A0A516V8I0 | 626-795 | None |
| A0A1G5AI89 | 509-661 | None |
| A0A1A0KGG2 | 9-148 | None |
| A0A2N0AYQ4 | 2-120 | None |
| A0A3A4VGG4 | 9-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.