DPCstruct | MC6423
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 82 ± 11 aa |
| Standard deviation of domain lengths | 10.98 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 30.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3F2TZT1 | 2-68 | YWRAWEALRHDRQYGALGGETPISYIAISRFAQDNEIPPADFTLFHRFMTAIDAEWLDHVARETELR |
| A0A1E3ESK9 | 12-84 | RVDLFGHLWFEATAFRELSTDRPVGFGRGPIPWRSIHHYAERYGLVQDDFDRFVEVIRAMDAAYLAYKTKPAE |
| A0A4D8QAI7 | 3-69 | None |
| V4P584 | 2-85 | None |
| A0A515KJV2 | 5-82 | None |
| A0A839LE12 | 11-110 | None |
| A0A840ZL72 | 1-83 | None |
| A0A327L4E3 | 8-108 | None |
| A0A4R9PWA5 | 25-107 | None |
| A0A355FBF5 | 3-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.