DPCstruct | MC6422
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 301 ± 31 aa |
| Standard deviation of domain lengths | 31.44 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 43.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A171JVH6 | 241-502 | LGNGKFDGAWLVQNFENLNPANTLWSKQYNLYAKVDTEAPRYLEFEKWWGGHVFLNGPEIQYIVDNLFVGNRLATAGLVTSDGIRID… |
| A0A1E3EKX4 | 36-320 | PLLDFNYELILGDGRFDGAWLVQNFENLKPKEVWEKYANLFTHLDEERERFLKFERWWNGFYFLSREEILAIVENLFIGNTLEQGKL… |
| A0A0L1MMD3 | 64-384 | None |
| A0A1E3VR62 | 309-574 | None |
| A0A433I7M1 | 23-323 | None |
| A0A7X9JEY9 | 9-309 | None |
| A0A1B8P3R2 | 45-390 | None |
| A0A562PUE7 | 274-614 | None |
| A0A2U3I0Y5 | 281-615 | None |
| A0A2D5HEF9 | 40-340 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.