DPCstruct | MC64219
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 70 ± 3 aa |
| Standard deviation of domain lengths | 3.31 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 90.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 62.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376TXI4 | 1-68 | MLEAQDLACATSSASSKLIHGGLRYLEHYEFRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPA |
| A0A3P7M5G1 | 1-74 | MKTALVELDDFSSGTSSRSTKLIHGGVRYLQAAIMKADREQYRMVKEALFERANLLQIAPHLSEPMPILLPVYK |
| A0A0C9N6C2 | 123-193 | None |
| A0A4Y2U256 | 87-160 | None |
| W4QVQ3 | 2-66 | None |
| A0A183VPS6 | 103-171 | None |
| A0A0R3RCF0 | 1-67 | None |
| A0A7R9HXS5 | 63-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.