DPCstruct | MC64215
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 64 ± 6 aa |
| Standard deviation of domain lengths | 6.19 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 57.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0582 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P6U672 | 1-62 | MNHVDLQRVCMSTADACLILANNRPVDPNQEDAANIMRVVAVKNYASHVRVIVQILQQSNKV |
| S4RMD4 | 151-210 | NPLDLARVKIEAADACMIIANKYCPDPDAEDASNIMRVISIKNYHPRIRVITQMLQYHNK |
| T1ENA6 | 103-169 | None |
| A0A5J5CSH7 | 293-352 | None |
| A0A553NRQ4 | 608-667 | None |
| A0A814UYU5 | 194-271 | None |
| A0A654HGR9 | 1-61 | None |
| A0A0S7FK53 | 126-185 | None |
| M7CF63 | 586-645 | None |
| A0A0F8CIX3 | 379-438 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.