DPCstruct | MC64213
Metacluster Properties and Pfam Annotations
| Number of structural domains | 76 |
|---|---|
| Mean domain length (aa) | 129 ± 16 aa |
| Standard deviation of domain lengths | 16.42 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 72.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 42.10 |
| Pfam Score | 97.73 |
| Assigned Pfam label(s) | PF04178- CL0220- PF15171 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A822DKY6 | 7-135 | DLQKIGLGLTIFGVGFIFLGMIFLFDKGLLAVGNILFLGGLCMIIGLERTVRFFFQSFKIKATALFFGGILLVLIGWPLTGIIIEFY… |
| A0A3P6T4M5 | 2-117 | SVGIAFIFLGMLLLFDGGLLALGNLIFILGLGLFIGAERVTRFFFQWHKVKGTSFFFGGMLVVIFGFPLIGMLIELYGSFLLFSGFL… |
| A0A7J6PID4 | 5-137 | None |
| T1EJP5 | 2-137 | None |
| A0A5F8AFT4 | 75-167 | None |
| A0A4V3WMU7 | 164-263 | None |
| A0A368FTE9 | 6-162 | None |
| A0A1Q9EMK0 | 954-1088 | None |
| A0A2S5BGD6 | 562-694 | None |
| A0A1S3DYN5 | 7-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.