DPCstruct | MC64212
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 122 ± 16 aa |
| Standard deviation of domain lengths | 16.34 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 49.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P6RQQ0 | 6-156 | ATRLLPVFYDARDTIESWETKVEQIIQFCHNSVTKLIGANASDTALKLFLNCAQAIDALPFGKQISLAYEFFSQAFTLFEQELSRSS… |
| A0A6J0K648 | 100-206 | IEVLSSVPCPELALRLYLQCAEAASDCDLEPVAYEFFTQAFILYEEEIADSKAQVTAIHLIIGTLQRINVFGVENRDTLTHKATGYS… |
| A0A7S0X9N3 | 15-130 | None |
| A0A7S3GBF2 | 3-121 | None |
| A0A1Q9DZ08 | 372-498 | None |
| T1HBM4 | 274-416 | None |
| A0A2H1BV72 | 12-133 | None |
| A0A1D6L802 | 291-398 | None |
| A0A2P8Z3I8 | 9-130 | None |
| A0A388K2R8 | 929-1036 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.