DPCstruct | MC642
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 353 ± 37 aa |
| Standard deviation of domain lengths | 36.73 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 22.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13387 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A849ZH90 | 69-452 | SVLTFSPGDHPFYKFGHNAILIYDDSKRGKRDYAKVYNYGTFSFGDPALIPKFFLGRFQYWLSAQTLQGTIAGYKRENRAIIEQELA… |
| A0A085EI33 | 2-290 | KFTKGDMNYFIANDRYVDFLNQYNYERRDVYEQELDIPLEFKQKLYDNLSKSMLSDERLYQYKFIDNNCTSKVVDIINKTLNAEVIT… |
| A0A3D4RL91 | 36-389 | None |
| A0A5C6M9V2 | 10-382 | None |
| A0A2E7B1D5 | 292-633 | None |
| A0A7C7FVD3 | 157-515 | None |
| A0A7Y1ZRC5 | 9-359 | None |
| A0A256WAS9 | 4-267 | None |
| A0A4Z0MRX5 | 33-354 | None |
| A0A843TAB7 | 122-508 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.