DPCstruct | MC64199
Metacluster Properties and Pfam Annotations
| Number of structural domains | 108 |
|---|---|
| Mean domain length (aa) | 141 ± 27 aa |
| Standard deviation of domain lengths | 27.04 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 82.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 14.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A847PHP0 | 19-131 | IYASSLKDGSYLITLDSSSSMFRVIKCELIVENNAMKAIMTMSGSGYGMVYMGTGKEALLDTEENYIPFVLNEEGAKTFTVPVEALD… |
| A0A163ZWJ4 | 10-142 | VQAPLAGANAALADGTYTVEFAVLKDQTNQTSTMDGYLQKPAKLEVVNGNKFVSVTLKNSDWIQFFKTEQNGSFVDATVVSTDTAAN… |
| A0A1R1DDW6 | 23-131 | None |
| A0A1R1CR52 | 475-573 | None |
| A0A2V1JNR2 | 1-139 | None |
| A0A0R1VAF1 | 152-255 | None |
| A0A1C6JNF7 | 127-236 | None |
| A0A413JBH0 | 349-497 | None |
| A0A1V5C0K4 | 18-166 | None |
| A0A5Q2NQC2 | 23-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.