DPCstruct | MC6419
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 83 ± 12 aa |
| Standard deviation of domain lengths | 11.88 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 40.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12083 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7F824 | 2-77 | LTITHTREAGTLIDGTERGDGTNVVLKAHRWRWSRNLGTWYVPQSRDRAAKVRTIETTAAALREAGHDVEVTIDDT |
| A0A5J5K8A5 | 64-129 | LIITHSRADGTHIDGTEPGNGVLAVARLHGFRMNRRRGRVEIPRSSGRAADWDSIQAAAAALRGAG |
| A0A0N1NWJ0 | 2-77 | None |
| A0A387HAV5 | 2-78 | None |
| A0A1H2CV78 | 2-78 | None |
| A0A429DNF3 | 106-205 | None |
| A0A0L6CPY9 | 1-76 | None |
| A0A7K2L604 | 9-85 | None |
| A0A4S2T8M8 | 300-397 | None |
| A0A0U3P2A5 | 49-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.