DPCstruct | MC64183
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 172 ± 19 aa |
| Standard deviation of domain lengths | 18.73 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 41.33 |
| Pfam Score | 60.00 |
| Assigned Pfam label(s) | PF15059- CL0530 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7LX09 | 1-176 | MVSRWIGEFQAAHKQPDEEVVFDVLCGDFNFDNCSPDDVLEQNHSLFEEYRDPCRAEAGKEKPWVIGTLLEQPSLYEEDVNSPEMLQ… |
| A0A2T7NHI8 | 493-639 | DEILKWIEEFRQETKDAKDKVLFDILCGDLNFDNISPGDKENREHAVFDVYTDPCRMFPGKDHDWTVGTEFKQIFMHDPSVKSPESL… |
| F6WVX2 | 384-563 | None |
| A0A437CIS4 | 636-811 | None |
| A0A7M7N5L6 | 1-212 | None |
| G3HKV1 | 230-406 | None |
| A0A4W6D0U9 | 444-621 | None |
| A0A821ZHX9 | 377-513 | None |
| A0A6P8FAK1 | 615-789 | None |
| A0A2I0LI43 | 25-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.