DPCstruct | MC64178
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 128 ± 29 aa |
| Standard deviation of domain lengths | 28.89 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 78.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 34.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A540X7I9 | 202-313 | HDKCTSGVPLSPASDPCVSSVCTADAYCCSSSWDSRCVGEVRTVCGSLTCSESDGTCAHSLCTPGASLVNHCDSAKADCVSAICAVD… |
| A0A017T610 | 275-386 | ACGHDKCSQGPALNGAACGTCVQSVCAADPYCCSTYWDSICVNEVYSICGSVTCDLGSCSHGVCGQGPALTNGCDSNGVVAAICAAD… |
| A0A1L6M2M8 | 39-169 | None |
| A0A7Y5NSE5 | 423-533 | None |
| A0A849Z8A2 | 77-209 | None |
| A0A3B8V2D1 | 71-173 | None |
| A0A2D5S4W9 | 395-504 | None |
| A0A017T6Z0 | 304-420 | None |
| D0LRL6 | 364-473 | None |
| A0A651GNN9 | 266-361 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.