DPCstruct | MC64175
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 135 ± 13 aa |
| Standard deviation of domain lengths | 13.05 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 32.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H7KW40 | 1-154 | MCPPRSAHYSLRRISFDALLLSHLHRVCDGMARPPNWSLVLRADAADPGSRDWQNLQRLIARTLPAMTEELQAIDEPILLTEPGLLA… |
| A0A849DN56 | 88-228 | LDEAAAALVDRHGAEIVDVTGVLLDALRAQAASKGVPWDAVRAADAAEPGSRPALGLASLVRAAIPAIEAAVGDAAAGKPEGTRPVL… |
| A0A150PEN4 | 87-220 | None |
| A0A1I4EQS4 | 485-607 | None |
| O86560 | 1386-1557 | None |
| A0A418N0Z8 | 562-694 | None |
| A0A1S9D0C2 | 923-1053 | None |
| A0A350CD22 | 64-191 | None |
| A0A846AKJ1 | 340-467 | None |
| A0A1C4VMA5 | 448-576 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.